PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G377500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 984aa    MW: 110685 Da    PI: 5.0719
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G377500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.9e-14853248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
  Sevir.3G377500.1.p  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                        78*****************************.************986 PP

2Myb_DNA-binding32.81.6e-1060103248
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
  Sevir.3G377500.1.p  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                         68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
CDDcd001677.15E-121053No hitNo description
PfamPF139214.6E-131070No hitNo description
SuperFamilySSF466896.47E-2133108IPR009057Homeodomain-like
CDDcd116591.65E-3055106No hitNo description
Gene3DG3DSA:1.10.10.603.4E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
PfamPF118315.2E-60406657IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 984 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACAKD ENYEPNDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDTRHR KRKRKGIDYN AEIPFEKQPP PGFYDTGGED RPLEHVQFPT  240
TIEELEGKRR ADIEAQLRKQ DIARNKILQR QDAPAAIMQA NKLNDPEAVT RRSKLMLPPP  300
QISDHELEEI AKMGNAGDPG LTEELGEGST ATRTLLASYS QTPRLGMTPL RTPQRTPAGK  360
GDAIMMEAEN LARLRESQTP LLGGDNPDLH PSDFSGVTPR KKEIQTPNPM ATPLASPGPG  420
VTPRIGMTPS RDGHNFGLTP KGTPFRDELR INEEVEMQDG TKLELRRQAE LKRSLRSGFA  480
SIPQPKNEYQ IVMPPITEDE KEEAEEKIEE DMSDRLARER AEEQARQEAL LRKRSKVLQR  540
SLPRPPTASV EIIRQSLIRS GESRSRSTFV PPTSLEQADE LINEELLRLL EHDNAKYPLD  600
EKTQKEKKKG SKRQQNGGSL VPEIDDFDED ELKEAGYMVE EEIQYLRVAM GHENESFEDF  660
VKAHDACQED LMFFPANNSY GLASVAGNAD KISALQNEFD IVKKRMDDEA KKASRLEQKI  720
KLLTQGYQVR AGKLWSQVQD TFKQMDTAST ELKCFQELQK QEHLAASYRT VNLTEEVNKQ  780
KALERTLQSR YGDLLSGFQR IQEQLEERKR QLKIQEAKEA ENRAQEEEVA ARNRAAEEEE  840
RKSRSIEEDG QTNKATDGEA AAGSKGTAED QMDVDNGNVD GEFVGPIPPA PDTEGDNVDV  900
SIQENAFNAQ SSETASTNDE AGKTDPAKSE GQHKADDSMA VDAGRQEERK DELATVGTSI  960
SEGHAAVSSD HGVSNEDNGV SPE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10332242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDTRHRKRKRK
2199204RKRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4589620.0AF458962.1 Zea mays CDC5 protein (CDC5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962961.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLK3Z3H80.0K3Z3H8_SETIT; Uncharacterized protein
STRINGSi021096m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44163553
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5